PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634644.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 481aa    MW: 54224.7 Da    PI: 5.0212
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634644.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
   XP_013634644.1 19 KGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLFRCGKSCRLRWANHL 66
                     79******************************************9986 PP

2Myb_DNA-binding47.73.7e-1572115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E++ +++++++lG++ W++ a+ ++ gRt++++k++w++
   XP_013634644.1  72 KGSFSPDEEKMIIELHARLGNK-WARMASQLP-GRTDNEIKNYWNT 115
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.3921466IPR017930Myb domain
SuperFamilySSF466893.52E-2916113IPR009057Homeodomain-like
SMARTSM007174.4E-141868IPR001005SANT/Myb domain
PfamPF002492.1E-141966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-222073IPR009057Homeodomain-like
CDDcd001671.25E-102166No hitNo description
PROSITE profilePS5129423.74167121IPR017930Myb domain
SMARTSM007174.8E-1571119IPR001005SANT/Myb domain
PfamPF002492.1E-1472115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2574120IPR009057Homeodomain-like
CDDcd001671.21E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MDGGGETRVA ETKVRGMKKG PWTTTEDAIL TEYVRKHGEG NWNAVQKNSG LFRCGKSCRL  60
RWANHLRPNL KKGSFSPDEE KMIIELHARL GNKWARMASQ LPGRTDNEIK NYWNTRMKRR  120
QRDGLPLYPQ ETQHQGIGND DEFEFNSSQF QNQDHGNHQN MFQYTYSSNT PSSSSSFSSS  180
SSQPSKMLCL DPLISSNPGL NQIPESPMNF SMFSLYNNSL ENDHSLDNDN NQFLKYSSSS  240
SNEFCNLNQL LEVPSENSDT NNTNKKDIDA MSYSSLLMGD HETRPSCFPF GLDNAVLELP  300
SSSKTPTHWF TSNTILDDGV PLDPPAGNSG LLDAVLEESQ ALSRRGNFND FTVSSSDLGE  360
DQDKRVKMDC ANRLINHNPS HLSSFETYPN FYKRYNEPTM EKAIVDDDDD ILMSLLNNFP  420
STTLLPDDWY GMKDIQTGVS QSGNHQDNKR VELHKAPPSP NTVDPLASLG SCYWDNMPSI  480
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-29191204104C-Myb DNA-Binding Domain
1msf_C1e-29191204104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634644.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0D3BST40.0A0A0D3BST4_BRAOL; Uncharacterized protein
STRINGBra005597.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.10.0myb domain protein 101